- Integrin alpha 6/CD49f Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85748
- Unconjugated
- CD49f, JEB6, ITGA6B, ITGA6A, VLA-6
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Integrin alpha 6/CD49f
- Immunohistochemistry, Immunohistochemistry-Paraffin
- IgG
- Rabbit
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: RVINLGKPLT NLGTATLNIQ WPKEISNGKW LLYLVKVESK GLEKVTCEPQ KEINSLNLTE SHNSRKKREI TEKQIDDNRK FSLFAERKYQ T
- integrin subunit alpha 6
- Novus Biologicals, a Bio-Techne Brand
- Polyclonal
- Immunogen affinity purified
- Signal Transduction
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQT
Specifications/Features
Available conjugates: Unconjugated